PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B02775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 90aa    MW: 9882.21 Da    PI: 8.2099
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B02775.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.91.5e-301876160
     ZF-HD_dimer  1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    +++vrY eC++NhAas+Gg+a+DGC+Ef+++ g egt aalkCaACgCHR+FHRr +++e
  Pahal.B02775.1 18 CCSVRYGECRRNHAASTGGYAIDGCREFIAE-GVEGTGAALKCAACGCHRSFHRRVQVYE 76
                    5789**************************8.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-25180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.4E-292173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.7E-232271IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.3962372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MKRLLIVRRC EPIVRFSCCS VRYGECRRNH AASTGGYAID GCREFIAEGV EGTGAALKCA  60
ACGCHRSFHR RVQVYEVAWD YGSDTSSTE*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956813.15e-56PREDICTED: mini zinc finger protein 2
SwissprotQ6ER221e-33MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBLK3ZY943e-56K3ZY94_SETIT; Uncharacterized protein
STRINGSi031576m1e-55(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-26mini zinc finger 1